PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00004401-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family M-type_MADS
Protein Properties Length: 95aa    MW: 10643.3 Da    PI: 10.8372
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00004401-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.76.5e-28959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krien + rqvtfskRr g+lKKA+ELS+LC+ae+a i+fs++g+lye+ss
  WALNUT_00004401-RA  9 KRIENATSRQVTFSKRRSGLLKKAFELSILCEAEIAAIVFSQKGRLYEFSS 59
                        79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.1E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.866161IPR002100Transcription factor, MADS-box
CDDcd002657.22E-37376No hitNo description
PRINTSPR004046.0E-30323IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.36E-28367IPR002100Transcription factor, MADS-box
PfamPF003197.1E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-303859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MVRGKIQMKR IENATSRQVT FSKRRSGLLK KAFELSILCE AEIAAIVFSQ KGRLYEFSSS  60
DYSQVRRQNS PRDLLSAGIL LFSFLPSSGV SEPSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S3e-19165165Myocyte-specific enhancer factor 2B
1tqe_R3e-19165165Myocyte-specific enhancer factor 2B
1tqe_Q3e-19165165Myocyte-specific enhancer factor 2B
1tqe_P3e-19165165Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007221139.16e-33hypothetical protein PRUPE_ppa019267mg
SwissprotQ9FIS19e-32AGL42_ARATH; MADS-box protein AGL42
TrEMBLM5XLE87e-33M5XLE8_PRUPE; Uncharacterized protein
STRINGVIT_16s0022g02400.t013e-32(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.44e-33AGAMOUS-like 42